SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 634499.EpC_25620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  634499.EpC_25620
Domain Number 1 Region: 106-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000115
Family NfeD domain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  634499.EpC_25620
Domain Number - Region: 5-79
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00131
Family Rhomboid-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 634499.EpC_25620
Sequence length 150
Comment (Erwinia pyrifoliae Ep1 96)
Sequence
MFDPLLANPWWLWLTLGGLLLAAEMLGASGYLLWSGIAAVLVSLLVWLVPLPWEWQGLSF
AILTILAALWWYRWLKSRQQRHPPSTLNQRGQQLIGRQLTLDAALVNGFGHVRIGDGNWR
VQADEDLPAGTQITVVAVEGITLRVVARSV
Download sequence
Identical sequences D2T403
634499.EpC_25620 WP_012668825.1.53124 WP_012668825.1.74942 gi|259909197|ref|YP_002649553.1| gi|387872151|ref|YP_005803531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]