SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 634503.NT01EI_1139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  634503.NT01EI_1139
Domain Number - Region: 19-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00288
Family Glycerol-3-phosphate transporter 0.045
Further Details:      
 
Domain Number - Region: 88-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0034
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 634503.NT01EI_1139
Sequence length 160
Comment (Edwardsiella ictaluri 93 146)
Sequence
MMAYLLQNPHGLWLTLGGLLLAAELLGAGGYALWSGCAALLVGLLHWLWPFGWEAQLTLF
ALLTVISALLWWRWQRRGAAEEAADSTLNQRGRQLIGQRALLEQPLVNGHGRLRLGDSSW
RVTCAQDLPAGQCVQVRAVSGITLEVIPCAPPRDSSRPDR
Download sequence
Identical sequences C5BHK6
WP_015870527.1.60554 WP_015870527.1.7078 WP_015870527.1.9917 gi|238919071|ref|YP_002932585.1| 634503.NT01EI_1139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]