SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_F6579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  63737.Npun_F6579
Domain Number - Region: 94-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000157
Family NfeD domain-like 0.0086
Further Details:      
 
Domain Number - Region: 10-76
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0209
Family LacY-like proton/sugar symporter 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_F6579
Sequence length 144
Comment (Nostoc punctiforme PCC 73102)
Sequence
MPSLTLIWLLAGAVLCLMELFLPSAFVAFMMGISAFVVALLSGVGLGNVWLQVVVWLLLS
TFLIVLSRRFLQPRRRKSKIQDAVIAETLTEIPPGKTGRVLYEGNSWQARCDDDKFTVAP
HQRVYVVRREGTTLIVIPENLLNS
Download sequence
Identical sequences B2J0E7
WP_012412773.1.44837 gi|186686584|ref|YP_001869780.1| 63737.Npun_F6579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]