SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 645127.ckrop_0933 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  645127.ckrop_0933
Domain Number 1 Region: 78-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000011
Family NfeD domain-like 0.005
Further Details:      
 
Weak hits

Sequence:  645127.ckrop_0933
Domain Number - Region: 20-65
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0602
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 645127.ckrop_0933
Sequence length 140
Comment (Corynebacterium kroppenstedtii DSM 44385)
Sequence
MWFIGAVLLAVLELFGGDFALLMLSGGALAAAGVSFFQAPLWVSVVVFAVVSLTLMFVLR
PFLKRKLSEKIETADFSPRALVGTTGETVEQISSSSGIVRLNGDFWSARSAFHDDVFEPG
DTVVVSRIEGNTAFVLERRD
Download sequence
Identical sequences C4LIN2
gi|237785525|ref|YP_002906230.1| 645127.ckrop_0933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]