SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 645462.CD196_0830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  645462.CD196_0830
Domain Number 1 Region: 101-171
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000017
Family NfeD domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 645462.CD196_0830
Sequence length 179
Comment (Clostridium difficile CD196)
Sequence
MICSLNLYSKTLYKHIIYIGFYNSYEKRVDSMKLIWLIVAVLFGIAEMLTPSLTLIWFSV
GAVILIFLSSFIESIFLQILIFAVISIAMLVVATKKIVKKDKGYKSNTNLQAMMSKKGIV
TEEISPNNTGLVVVEHETWTAISIDGEKIEKGSTVEVLKIEGVKLVVKKVDATVNVTNQ
Download sequence
Identical sequences A0A0H3N141 C9YJR0
gi|260682578|ref|YP_003213863.1| gi|260686178|ref|YP_003217311.1| 645462.CD196_0830 645463.CDR20291_0810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]