SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 645463.CDR20291_0117 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  645463.CDR20291_0117
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 645463.CDR20291_0117
Sequence length 185
Comment (Clostridium difficile R20291)
Sequence
MSTARVICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSNEPV
GSPLITDDATAAILLNIPAFEKFKDDVIPGGKIIVNSSLIKEKVDRTDVDVYYIPANELA
AELGNDKVANMIMLGAYLKVSDTVDIESVLEAFKKVFGPRKEKFVPLNREALQKGMDATC
SKATN
Download sequence
Identical sequences A0A031WCI5 A0A0H3MYC7 A0A0J0U7P1 A0A125V1B7 A0A1F2DC29 A0A2I2JLU5 C9YHS6 D5Q952 D5S4T0 G6B316 G6BHP7 Q18CK6 T4ILR2 U3UCA2 U3UXC2 U3V6M6
WP_003420711.1.100055 WP_003420711.1.100097 WP_003420711.1.100099 WP_003420711.1.100107 WP_003420711.1.100118 WP_003420711.1.100139 WP_003420711.1.100513 WP_003420711.1.100570 WP_003420711.1.100660 WP_003420711.1.100831 WP_003420711.1.100923 WP_003420711.1.100977 WP_003420711.1.101035 WP_003420711.1.101125 WP_003420711.1.101279 WP_003420711.1.10130 WP_003420711.1.101316 WP_003420711.1.101532 WP_003420711.1.101861 WP_003420711.1.101929 WP_003420711.1.102074 WP_003420711.1.102095 WP_003420711.1.10483 WP_003420711.1.10488 WP_003420711.1.10582 WP_003420711.1.10691 WP_003420711.1.10793 WP_003420711.1.10795 WP_003420711.1.11025 WP_003420711.1.11224 WP_003420711.1.11278 WP_003420711.1.11320 WP_003420711.1.11372 WP_003420711.1.11398 WP_003420711.1.1167 WP_003420711.1.1179 WP_003420711.1.11937 WP_003420711.1.11959 WP_003420711.1.12066 WP_003420711.1.12169 WP_003420711.1.12385 WP_003420711.1.1254 WP_003420711.1.12629 WP_003420711.1.12632 WP_003420711.1.12659 WP_003420711.1.1273 WP_003420711.1.12734 WP_003420711.1.12807 WP_003420711.1.12809 WP_003420711.1.12953 WP_003420711.1.13040 WP_003420711.1.13251 WP_003420711.1.13273 WP_003420711.1.13398 WP_003420711.1.13418 WP_003420711.1.13730 WP_003420711.1.13823 WP_003420711.1.13841 WP_003420711.1.13859 WP_003420711.1.14045 WP_003420711.1.141 WP_003420711.1.14170 WP_003420711.1.14177 WP_003420711.1.14205 WP_003420711.1.1422 WP_003420711.1.14259 WP_003420711.1.14330 WP_003420711.1.14352 WP_003420711.1.1445 WP_003420711.1.14457 WP_003420711.1.14483 WP_003420711.1.14579 WP_003420711.1.14674 WP_003420711.1.14686 WP_003420711.1.14698 WP_003420711.1.14848 WP_003420711.1.1494 WP_003420711.1.15083 WP_003420711.1.15097 WP_003420711.1.15192 WP_003420711.1.15205 WP_003420711.1.15310 WP_003420711.1.15435 WP_003420711.1.15908 WP_003420711.1.16012 WP_003420711.1.16135 WP_003420711.1.16185 WP_003420711.1.16190 WP_003420711.1.16376 WP_003420711.1.16520 WP_003420711.1.16728 WP_003420711.1.16897 WP_003420711.1.169 WP_003420711.1.16931 WP_003420711.1.16966 WP_003420711.1.1705 WP_003420711.1.17371 WP_003420711.1.17413 WP_003420711.1.17463 WP_003420711.1.17512 WP_003420711.1.17611 WP_003420711.1.17638 WP_003420711.1.17808 WP_003420711.1.17851 WP_003420711.1.17879 WP_003420711.1.17908 WP_003420711.1.17960 WP_003420711.1.17998 WP_003420711.1.18060 WP_003420711.1.18207 WP_003420711.1.18212 WP_003420711.1.18298 WP_003420711.1.1838 WP_003420711.1.18455 WP_003420711.1.18462 WP_003420711.1.18551 WP_003420711.1.18680 WP_003420711.1.18805 WP_003420711.1.18970 WP_003420711.1.19088 WP_003420711.1.19152 WP_003420711.1.1926 WP_003420711.1.19290 WP_003420711.1.1934 WP_003420711.1.19627 WP_003420711.1.19648 WP_003420711.1.19704 WP_003420711.1.19899 WP_003420711.1.19956 WP_003420711.1.1999 WP_003420711.1.2002 WP_003420711.1.20132 WP_003420711.1.20184 WP_003420711.1.20302 WP_003420711.1.20313 WP_003420711.1.20481 WP_003420711.1.20650 WP_003420711.1.20728 WP_003420711.1.20872 WP_003420711.1.20875 WP_003420711.1.20960 WP_003420711.1.21000 WP_003420711.1.21048 WP_003420711.1.21201 WP_003420711.1.21220 WP_003420711.1.21417 WP_003420711.1.21502 WP_003420711.1.21520 WP_003420711.1.21618 WP_003420711.1.21704 WP_003420711.1.21893 WP_003420711.1.21925 WP_003420711.1.21980 WP_003420711.1.22020 WP_003420711.1.22079 WP_003420711.1.22128 WP_003420711.1.22222 WP_003420711.1.22228 WP_003420711.1.22313 WP_003420711.1.22357 WP_003420711.1.22395 WP_003420711.1.22411 WP_003420711.1.22417 WP_003420711.1.22568 WP_003420711.1.22569 WP_003420711.1.22615 WP_003420711.1.22768 WP_003420711.1.22893 WP_003420711.1.22937 WP_003420711.1.23096 WP_003420711.1.23208 WP_003420711.1.23287 WP_003420711.1.23338 WP_003420711.1.2363 WP_003420711.1.24197 WP_003420711.1.24457 WP_003420711.1.24520 WP_003420711.1.24826 WP_003420711.1.24889 WP_003420711.1.24900 WP_003420711.1.24987 WP_003420711.1.25128 WP_003420711.1.25416 WP_003420711.1.25761 WP_003420711.1.26024 WP_003420711.1.26044 WP_003420711.1.26358 WP_003420711.1.26482 WP_003420711.1.26494 WP_003420711.1.26697 WP_003420711.1.26829 WP_003420711.1.26940 WP_003420711.1.27300 WP_003420711.1.27563 WP_003420711.1.2758 WP_003420711.1.27677 WP_003420711.1.27708 WP_003420711.1.27824 WP_003420711.1.27872 WP_003420711.1.27881 WP_003420711.1.27890 WP_003420711.1.27967 WP_003420711.1.27989 WP_003420711.1.27996 WP_003420711.1.28055 WP_003420711.1.28410 WP_003420711.1.28638 WP_003420711.1.28715 WP_003420711.1.28856 WP_003420711.1.28882 WP_003420711.1.28890 WP_003420711.1.28930 WP_003420711.1.2923 WP_003420711.1.293 WP_003420711.1.29600 WP_003420711.1.29757 WP_003420711.1.2982 WP_003420711.1.29891 WP_003420711.1.29939 WP_003420711.1.3024 WP_003420711.1.303 WP_003420711.1.3031 WP_003420711.1.30420 WP_003420711.1.30431 WP_003420711.1.30463 WP_003420711.1.30519 WP_003420711.1.30521 WP_003420711.1.30743 WP_003420711.1.30841 WP_003420711.1.30953 WP_003420711.1.31160 WP_003420711.1.31183 WP_003420711.1.31203 WP_003420711.1.31292 WP_003420711.1.31309 WP_003420711.1.31351 WP_003420711.1.31385 WP_003420711.1.31453 WP_003420711.1.31475 WP_003420711.1.31477 WP_003420711.1.31519 WP_003420711.1.31637 WP_003420711.1.31719 WP_003420711.1.31742 WP_003420711.1.31960 WP_003420711.1.31969 WP_003420711.1.32008 WP_003420711.1.32066 WP_003420711.1.32119 WP_003420711.1.32166 WP_003420711.1.32197 WP_003420711.1.32218 WP_003420711.1.32230 WP_003420711.1.32294 WP_003420711.1.32699 WP_003420711.1.32769 WP_003420711.1.32776 WP_003420711.1.32842 WP_003420711.1.32953 WP_003420711.1.33056 WP_003420711.1.33098 WP_003420711.1.33164 WP_003420711.1.33275 WP_003420711.1.33298 WP_003420711.1.33332 WP_003420711.1.33349 WP_003420711.1.3340 WP_003420711.1.33514 WP_003420711.1.33810 WP_003420711.1.34388 WP_003420711.1.34489 WP_003420711.1.34545 WP_003420711.1.34641 WP_003420711.1.34800 WP_003420711.1.34985 WP_003420711.1.34989 WP_003420711.1.35 WP_003420711.1.35002 WP_003420711.1.35137 WP_003420711.1.35181 WP_003420711.1.35187 WP_003420711.1.35234 WP_003420711.1.35709 WP_003420711.1.35832 WP_003420711.1.35884 WP_003420711.1.36078 WP_003420711.1.36257 WP_003420711.1.36338 WP_003420711.1.36738 WP_003420711.1.36835 WP_003420711.1.37255 WP_003420711.1.374 WP_003420711.1.37493 WP_003420711.1.37597 WP_003420711.1.37861 WP_003420711.1.3789 WP_003420711.1.37957 WP_003420711.1.37981 WP_003420711.1.38305 WP_003420711.1.38338 WP_003420711.1.38692 WP_003420711.1.38775 WP_003420711.1.38814 WP_003420711.1.38924 WP_003420711.1.38986 WP_003420711.1.39008 WP_003420711.1.3913 WP_003420711.1.39213 WP_003420711.1.39350 WP_003420711.1.39382 WP_003420711.1.39442 WP_003420711.1.39525 WP_003420711.1.39621 WP_003420711.1.39783 WP_003420711.1.39874 WP_003420711.1.39876 WP_003420711.1.39975 WP_003420711.1.39981 WP_003420711.1.40030 WP_003420711.1.40294 WP_003420711.1.40313 WP_003420711.1.40447 WP_003420711.1.40516 WP_003420711.1.40522 WP_003420711.1.40557 WP_003420711.1.407 WP_003420711.1.40775 WP_003420711.1.40891 WP_003420711.1.40959 WP_003420711.1.40966 WP_003420711.1.41131 WP_003420711.1.4121 WP_003420711.1.41334 WP_003420711.1.41342 WP_003420711.1.4137 WP_003420711.1.41506 WP_003420711.1.41534 WP_003420711.1.41641 WP_003420711.1.41687 WP_003420711.1.41818 WP_003420711.1.41995 WP_003420711.1.42035 WP_003420711.1.4204 WP_003420711.1.42066 WP_003420711.1.42532 WP_003420711.1.42533 WP_003420711.1.42610 WP_003420711.1.42664 WP_003420711.1.43112 WP_003420711.1.4315 WP_003420711.1.4321 WP_003420711.1.43388 WP_003420711.1.43490 WP_003420711.1.43519 WP_003420711.1.43579 WP_003420711.1.43663 WP_003420711.1.43824 WP_003420711.1.4383 WP_003420711.1.44030 WP_003420711.1.44105 WP_003420711.1.44149 WP_003420711.1.44198 WP_003420711.1.44241 WP_003420711.1.44470 WP_003420711.1.44471 WP_003420711.1.44729 WP_003420711.1.45017 WP_003420711.1.45059 WP_003420711.1.45142 WP_003420711.1.45165 WP_003420711.1.45209 WP_003420711.1.45257 WP_003420711.1.45352 WP_003420711.1.45554 WP_003420711.1.4573 WP_003420711.1.45938 WP_003420711.1.45986 WP_003420711.1.46066 WP_003420711.1.46117 WP_003420711.1.46274 WP_003420711.1.46280 WP_003420711.1.46305 WP_003420711.1.46522 WP_003420711.1.4698 WP_003420711.1.47016 WP_003420711.1.47121 WP_003420711.1.47173 WP_003420711.1.47227 WP_003420711.1.47228 WP_003420711.1.47479 WP_003420711.1.47615 WP_003420711.1.47708 WP_003420711.1.47729 WP_003420711.1.47940 WP_003420711.1.48220 WP_003420711.1.48246 WP_003420711.1.48279 WP_003420711.1.48491 WP_003420711.1.48733 WP_003420711.1.48746 WP_003420711.1.48772 WP_003420711.1.48935 WP_003420711.1.48980 WP_003420711.1.48983 WP_003420711.1.48991 WP_003420711.1.49020 WP_003420711.1.49054 WP_003420711.1.49065 WP_003420711.1.4908 WP_003420711.1.49092 WP_003420711.1.49230 WP_003420711.1.49310 WP_003420711.1.49339 WP_003420711.1.49451 WP_003420711.1.4948 WP_003420711.1.49633 WP_003420711.1.50159 WP_003420711.1.50341 WP_003420711.1.50460 WP_003420711.1.50495 WP_003420711.1.5073 WP_003420711.1.50865 WP_003420711.1.51007 WP_003420711.1.51166 WP_003420711.1.51235 WP_003420711.1.51675 WP_003420711.1.5187 WP_003420711.1.51996 WP_003420711.1.52073 WP_003420711.1.52164 WP_003420711.1.52266 WP_003420711.1.52278 WP_003420711.1.52294 WP_003420711.1.52311 WP_003420711.1.52330 WP_003420711.1.52383 WP_003420711.1.52402 WP_003420711.1.52466 WP_003420711.1.52525 WP_003420711.1.52789 WP_003420711.1.52958 WP_003420711.1.52997 WP_003420711.1.53008 WP_003420711.1.53044 WP_003420711.1.53055 WP_003420711.1.53288 WP_003420711.1.5337 WP_003420711.1.53504 WP_003420711.1.53704 WP_003420711.1.53710 WP_003420711.1.53729 WP_003420711.1.53987 WP_003420711.1.54058 WP_003420711.1.54153 WP_003420711.1.5423 WP_003420711.1.54262 WP_003420711.1.54350 WP_003420711.1.54586 WP_003420711.1.54593 WP_003420711.1.54692 WP_003420711.1.55055 WP_003420711.1.55101 WP_003420711.1.5521 WP_003420711.1.55302 WP_003420711.1.55371 WP_003420711.1.55391 WP_003420711.1.5558 WP_003420711.1.559 WP_003420711.1.56006 WP_003420711.1.56217 WP_003420711.1.56252 WP_003420711.1.56323 WP_003420711.1.56337 WP_003420711.1.56556 WP_003420711.1.5657 WP_003420711.1.5661 WP_003420711.1.5664 WP_003420711.1.56664 WP_003420711.1.56711 WP_003420711.1.56754 WP_003420711.1.56927 WP_003420711.1.56998 WP_003420711.1.57099 WP_003420711.1.57337 WP_003420711.1.5750 WP_003420711.1.57711 WP_003420711.1.57827 WP_003420711.1.58015 WP_003420711.1.58216 WP_003420711.1.58304 WP_003420711.1.58315 WP_003420711.1.58323 WP_003420711.1.58463 WP_003420711.1.58531 WP_003420711.1.58665 WP_003420711.1.58677 WP_003420711.1.58711 WP_003420711.1.58818 WP_003420711.1.58956 WP_003420711.1.59032 WP_003420711.1.5905 WP_003420711.1.59588 WP_003420711.1.59618 WP_003420711.1.59628 WP_003420711.1.59707 WP_003420711.1.59752 WP_003420711.1.59990 WP_003420711.1.60040 WP_003420711.1.6031 WP_003420711.1.60482 WP_003420711.1.60563 WP_003420711.1.6070 WP_003420711.1.60957 WP_003420711.1.60998 WP_003420711.1.61042 WP_003420711.1.61140 WP_003420711.1.61293 WP_003420711.1.61492 WP_003420711.1.61679 WP_003420711.1.61716 WP_003420711.1.61866 WP_003420711.1.61972 WP_003420711.1.62049 WP_003420711.1.62095 WP_003420711.1.62128 WP_003420711.1.62340 WP_003420711.1.62577 WP_003420711.1.62624 WP_003420711.1.62637 WP_003420711.1.62797 WP_003420711.1.62941 WP_003420711.1.62986 WP_003420711.1.63020 WP_003420711.1.63059 WP_003420711.1.63237 WP_003420711.1.63239 WP_003420711.1.63248 WP_003420711.1.63343 WP_003420711.1.63378 WP_003420711.1.63516 WP_003420711.1.63570 WP_003420711.1.63581 WP_003420711.1.63598 WP_003420711.1.63599 WP_003420711.1.63696 WP_003420711.1.63804 WP_003420711.1.63852 WP_003420711.1.63853 WP_003420711.1.63950 WP_003420711.1.64020 WP_003420711.1.64092 WP_003420711.1.64197 WP_003420711.1.64369 WP_003420711.1.64447 WP_003420711.1.64546 WP_003420711.1.64573 WP_003420711.1.64859 WP_003420711.1.65064 WP_003420711.1.65067 WP_003420711.1.65313 WP_003420711.1.65369 WP_003420711.1.65889 WP_003420711.1.66084 WP_003420711.1.66119 WP_003420711.1.66237 WP_003420711.1.66439 WP_003420711.1.66474 WP_003420711.1.66565 WP_003420711.1.66587 WP_003420711.1.66608 WP_003420711.1.66643 WP_003420711.1.6671 WP_003420711.1.6675 WP_003420711.1.66805 WP_003420711.1.66847 WP_003420711.1.6685 WP_003420711.1.66887 WP_003420711.1.66888 WP_003420711.1.66900 WP_003420711.1.670 WP_003420711.1.67303 WP_003420711.1.67308 WP_003420711.1.6736 WP_003420711.1.67528 WP_003420711.1.67689 WP_003420711.1.67695 WP_003420711.1.67711 WP_003420711.1.6792 WP_003420711.1.67951 WP_003420711.1.68150 WP_003420711.1.68276 WP_003420711.1.68322 WP_003420711.1.68955 WP_003420711.1.6898 WP_003420711.1.68980 WP_003420711.1.69114 WP_003420711.1.692 WP_003420711.1.69220 WP_003420711.1.69333 WP_003420711.1.69495 WP_003420711.1.69708 WP_003420711.1.6994 WP_003420711.1.700 WP_003420711.1.70152 WP_003420711.1.70179 WP_003420711.1.70231 WP_003420711.1.70320 WP_003420711.1.70464 WP_003420711.1.70695 WP_003420711.1.70710 WP_003420711.1.70820 WP_003420711.1.70886 WP_003420711.1.71079 WP_003420711.1.71119 WP_003420711.1.713 WP_003420711.1.71384 WP_003420711.1.71477 WP_003420711.1.7156 WP_003420711.1.71745 WP_003420711.1.7199 WP_003420711.1.72113 WP_003420711.1.72245 WP_003420711.1.72468 WP_003420711.1.72483 WP_003420711.1.72560 WP_003420711.1.72681 WP_003420711.1.72682 WP_003420711.1.72891 WP_003420711.1.72909 WP_003420711.1.72914 WP_003420711.1.72994 WP_003420711.1.73026 WP_003420711.1.73116 WP_003420711.1.7322 WP_003420711.1.73836 WP_003420711.1.73852 WP_003420711.1.73931 WP_003420711.1.74050 WP_003420711.1.74116 WP_003420711.1.74126 WP_003420711.1.74672 WP_003420711.1.74678 WP_003420711.1.74680 WP_003420711.1.74779 WP_003420711.1.74835 WP_003420711.1.74897 WP_003420711.1.75026 WP_003420711.1.751 WP_003420711.1.75210 WP_003420711.1.75226 WP_003420711.1.75287 WP_003420711.1.75454 WP_003420711.1.75638 WP_003420711.1.75659 WP_003420711.1.76207 WP_003420711.1.7650 WP_003420711.1.76550 WP_003420711.1.76552 WP_003420711.1.76603 WP_003420711.1.76664 WP_003420711.1.76687 WP_003420711.1.76793 WP_003420711.1.76813 WP_003420711.1.76882 WP_003420711.1.76924 WP_003420711.1.7696 WP_003420711.1.77092 WP_003420711.1.77102 WP_003420711.1.77473 WP_003420711.1.77509 WP_003420711.1.7755 WP_003420711.1.77639 WP_003420711.1.77782 WP_003420711.1.77842 WP_003420711.1.77942 WP_003420711.1.78123 WP_003420711.1.78579 WP_003420711.1.78949 WP_003420711.1.79125 WP_003420711.1.7916 WP_003420711.1.79199 WP_003420711.1.79221 WP_003420711.1.79309 WP_003420711.1.79344 WP_003420711.1.79437 WP_003420711.1.79611 WP_003420711.1.79673 WP_003420711.1.79680 WP_003420711.1.79703 WP_003420711.1.79836 WP_003420711.1.79956 WP_003420711.1.80052 WP_003420711.1.80144 WP_003420711.1.80342 WP_003420711.1.80379 WP_003420711.1.80455 WP_003420711.1.80504 WP_003420711.1.80575 WP_003420711.1.80610 WP_003420711.1.80963 WP_003420711.1.81035 WP_003420711.1.81044 WP_003420711.1.81208 WP_003420711.1.81299 WP_003420711.1.81351 WP_003420711.1.81402 WP_003420711.1.81605 WP_003420711.1.81777 WP_003420711.1.82002 WP_003420711.1.82084 WP_003420711.1.82150 WP_003420711.1.82169 WP_003420711.1.82335 WP_003420711.1.82635 WP_003420711.1.82701 WP_003420711.1.82920 WP_003420711.1.8314 WP_003420711.1.83148 WP_003420711.1.83175 WP_003420711.1.83255 WP_003420711.1.83287 WP_003420711.1.83288 WP_003420711.1.83318 WP_003420711.1.83348 WP_003420711.1.834 WP_003420711.1.83477 WP_003420711.1.83515 WP_003420711.1.83641 WP_003420711.1.83822 WP_003420711.1.83918 WP_003420711.1.84195 WP_003420711.1.84253 WP_003420711.1.84528 WP_003420711.1.84606 WP_003420711.1.84646 WP_003420711.1.84843 WP_003420711.1.84880 WP_003420711.1.84923 WP_003420711.1.85020 WP_003420711.1.85127 WP_003420711.1.85214 WP_003420711.1.85219 WP_003420711.1.8527 WP_003420711.1.85420 WP_003420711.1.85442 WP_003420711.1.85454 WP_003420711.1.85776 WP_003420711.1.85863 WP_003420711.1.8587 WP_003420711.1.85874 WP_003420711.1.85932 WP_003420711.1.86008 WP_003420711.1.86011 WP_003420711.1.86049 WP_003420711.1.86088 WP_003420711.1.86094 WP_003420711.1.86116 WP_003420711.1.86117 WP_003420711.1.86328 WP_003420711.1.86395 WP_003420711.1.86534 WP_003420711.1.86618 WP_003420711.1.86743 WP_003420711.1.86767 WP_003420711.1.86837 WP_003420711.1.86914 WP_003420711.1.87058 WP_003420711.1.87195 WP_003420711.1.87326 WP_003420711.1.87454 WP_003420711.1.87714 WP_003420711.1.87723 WP_003420711.1.87730 WP_003420711.1.87918 WP_003420711.1.87932 WP_003420711.1.88091 WP_003420711.1.882 WP_003420711.1.88268 WP_003420711.1.88332 WP_003420711.1.88364 WP_003420711.1.88372 WP_003420711.1.88377 WP_003420711.1.88608 WP_003420711.1.88640 WP_003420711.1.88996 WP_003420711.1.89052 WP_003420711.1.89196 WP_003420711.1.89337 WP_003420711.1.89364 WP_003420711.1.89457 WP_003420711.1.89541 WP_003420711.1.89629 WP_003420711.1.89697 WP_003420711.1.8984 WP_003420711.1.89994 WP_003420711.1.90076 WP_003420711.1.90101 WP_003420711.1.90164 WP_003420711.1.90329 WP_003420711.1.9041 WP_003420711.1.90491 WP_003420711.1.90555 WP_003420711.1.90643 WP_003420711.1.9083 WP_003420711.1.90921 WP_003420711.1.90938 WP_003420711.1.90981 WP_003420711.1.90985 WP_003420711.1.91065 WP_003420711.1.91254 WP_003420711.1.91314 WP_003420711.1.91406 WP_003420711.1.91570 WP_003420711.1.91648 WP_003420711.1.92075 WP_003420711.1.92284 WP_003420711.1.92371 WP_003420711.1.92658 WP_003420711.1.92697 WP_003420711.1.92941 WP_003420711.1.93044 WP_003420711.1.93171 WP_003420711.1.93313 WP_003420711.1.93360 WP_003420711.1.93480 WP_003420711.1.93615 WP_003420711.1.93687 WP_003420711.1.93717 WP_003420711.1.93766 WP_003420711.1.93782 WP_003420711.1.93798 WP_003420711.1.93802 WP_003420711.1.93830 WP_003420711.1.9393 WP_003420711.1.93968 WP_003420711.1.94067 WP_003420711.1.94073 WP_003420711.1.94166 WP_003420711.1.94427 WP_003420711.1.94768 WP_003420711.1.94831 WP_003420711.1.94968 WP_003420711.1.95095 WP_003420711.1.95173 WP_003420711.1.9522 WP_003420711.1.95350 WP_003420711.1.95517 WP_003420711.1.9580 WP_003420711.1.95847 WP_003420711.1.95893 WP_003420711.1.96113 WP_003420711.1.96503 WP_003420711.1.96505 WP_003420711.1.9666 WP_003420711.1.96690 WP_003420711.1.96765 WP_003420711.1.97432 WP_003420711.1.97458 WP_003420711.1.97672 WP_003420711.1.97682 WP_003420711.1.97806 WP_003420711.1.98037 WP_003420711.1.98514 WP_003420711.1.98622 WP_003420711.1.98698 WP_003420711.1.98715 WP_003420711.1.98748 WP_003420711.1.98856 WP_003420711.1.98913 WP_003420711.1.98997 WP_003420711.1.99064 WP_003420711.1.99134 WP_003420711.1.99333 WP_003420711.1.99542 WP_003420711.1.99545 WP_003420711.1.99731 WP_003420711.1.9986 YP_001086587.1.32744 gi|260681896|ref|YP_003213181.1| gi|384359448|ref|YP_006197300.1| gi|260685494|ref|YP_003216627.1| gi|126697690|ref|YP_001086587.1| 272563.CD0118 645462.CD196_0130 645463.CDR20291_0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]