SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 65393.PCC7424_0944 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  65393.PCC7424_0944
Domain Number - Region: 39-104
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0458
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 65393.PCC7424_0944
Sequence length 120
Comment (Cyanothece PCC 7424)
Sequence
MNKDQWVIIAFTIIAIGVSLGVLFVILVKLKRGKTNINSLVKLNQIVGTIGKVQIPFDQN
SKGKVRVKVKGSLIDLVAVTNFPAQFQLGEDVLIIEFKENKVWVVPEDYLRKTKHQESKK
Download sequence
Identical sequences B7KIJ4
WP_012598347.1.63236 gi|218437939|ref|YP_002376268.1| 65393.PCC7424_0944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]