SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 65393.PCC7424_2246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  65393.PCC7424_2246
Domain Number - Region: 92-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00107
Family NfeD domain-like 0.012
Further Details:      
 
Domain Number - Region: 10-75
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00562
Family Glycerol-3-phosphate transporter 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 65393.PCC7424_2246
Sequence length 143
Comment (Cyanothece PCC 7424)
Sequence
MLSSPVIWLIAGSILCLMEFIFPTAFVAFMMGISAFVVALIAFLVPHLGTQVVLWLILST
ISIILSRRWLTPRKNLRRLSEDTEGQTLTEIAPGQAGRVLYEGNSWRAMCDDETLSIPAH
QKVYIVRRKGNTLFVVPANLLHS
Download sequence
Identical sequences B7KHH3
gi|218439207|ref|YP_002377536.1| 65393.PCC7424_2246 WP_015954273.1.63236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]