SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 66692.ABC0486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  66692.ABC0486
Domain Number 1 Region: 6-160
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 6.63e-17
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 66692.ABC0486
Sequence length 162
Comment (Bacillus clausii KSM-K16)
Sequence
MKKFQCDIVTLPAYRAMGMKWNGPYSDVSQLKEVIHTMEHRVEELKGVINPNIQLGLSYH
TRNDGFEHYSVFEVKRTQPLLEGMVEIDVPEMTYFVTTHQKGENIGQTYEQIKQWLAESE
YTPFQDSSRQFYDPLPIKHERYPKDRDLLDPHFEILIPVTTK
Download sequence
Identical sequences Q5WKS8
66692.ABC0486 gi|56962264|ref|YP_173988.1| WP_011245345.1.16870 WP_011245345.1.55712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]