SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 66692.ABC1671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  66692.ABC1671
Domain Number 1 Region: 16-203
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.54e-26
Family Clp protease, ClpP subunit 0.026
Further Details:      
 
Domain Number 2 Region: 383-443
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000772
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 66692.ABC1671
Sequence length 454
Comment (Bacillus clausii KSM-K16)
Sequence
MGKWMKFALVSWLLACVLLPFQVLANQADSKNASIYVIPIEQTVERGLEAFLERSFSEAE
ENGADHIILNINTPGGAVDAAGHIANIINSTDIPVTAFINSEAISAGAYIALNADEIIMV
PNGQIGSAGVIDGAGNAAEEKTQSLWISRMKTAASEHGPEGGRNPDYAEAMANAEFDVEG
FPSGYLTLNAKQAYEVGYAEAIKDDLAGVLDYLGYDEEEVHVTEANVSIAEQIARFVTNP
IVIPILLSIGSLGLIMELYSPGFGIPGTMGISALLLFFFGHMVAGFAGWESLILVVIGAV
LLGVEFMAPGFGIFGLLGIGLIVGGFFMASFSTTVMVFSVGIALFVSIVAVIVLFVFFGD
KGPWKKLVLSAQTTAAEGYLSAETNKALIGMEGKALSVLRPAGIALIGDERLDVVSEGGY
IEKGSSLKVIHVSGARVVVRKVEPVQSLKKEETD
Download sequence
Identical sequences Q5WHE9
WP_011246515.1.28484 WP_011246515.1.55712 66692.ABC1671 gi|56963436|ref|YP_175167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]