SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 66692.ABC1712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  66692.ABC1712
Domain Number 1 Region: 149-209
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000628
Family NfeD domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 66692.ABC1712
Sequence length 223
Comment (Bacillus clausii KSM-K16)
Sequence
MIDWLDSASIGFIVVAFGTLFLIGELLVRVRGLFGLLGIGLICMYFIYHLNGDVGTWVIV
FYLIGLGLIIFDGNVTSDGTIAAIGVILMIVGLAIPAPDFVYGVLVSFATVIGAFASLLF
LKVFPHRNMWAKMTLKDQLSSEKGYNSMNESYKELVGKKGIALTDFRPTGTIDIEGNPYS
ATSGGRWIKADTEVEVVSVDGTRILVKAVEVENEDANQSKDHQ
Download sequence
Identical sequences A0A268P5D7 Q5WHA8
66692.ABC1712 gi|56963477|ref|YP_175208.1| WP_011246556.1.16870 WP_011246556.1.28484 WP_011246556.1.55712 WP_011246556.1.6971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]