SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 668336.D11S_0392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  668336.D11S_0392
Domain Number 1 Region: 60-149
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.26e-24
Family Ribosomal protein L9 C-domain 0.000023
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.05e-19
Family Ribosomal protein L9 N-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 668336.D11S_0392
Sequence length 149
Comment (Aggregatibacter actinomycetemcomitans D11S 1)
Sequence
MQVILLDKIAHLGKVGDQVNVKSGYARNYLIPQGKAVMATKANIEHFEARRAELEEKAAK
VLAAAVDRAERLEALGSVTIASKAGDEGRLFGSIGTRDIADAITAKGVEVAKSEVRLPNG
LIRTLGEHEVTFQFHGEVLSHLNVIIVAE
Download sequence
Identical sequences A0A1C7C480 C9R1W6 X2K0V3
gi|261867099|ref|YP_003255021.1| gi|365966901|ref|YP_004948463.1| 668336.D11S_0392 WP_005544876.1.101610 WP_005544876.1.12069 WP_005544876.1.13356 WP_005544876.1.13588 WP_005544876.1.16246 WP_005544876.1.18228 WP_005544876.1.24063 WP_005544876.1.63179 WP_005544876.1.64647 WP_005544876.1.69783 WP_005544876.1.90379 WP_005544876.1.98423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]