SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 668336.D11S_1671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  668336.D11S_1671
Domain Number - Region: 91-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000144
Family NfeD domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 668336.D11S_1671
Sequence length 148
Comment (Aggregatibacter actinomycetemcomitans D11S 1)
Sequence
MEWLADWGVWHWLILGFILLIAEVVIPGVFLLWWGLAAIVVAGIMKFIPALPLSALAVIY
AVIAIILSIIWWRYQHGKDQIDQSKSVLNQRDHAMIGVQGKVLTIAENGIGRGAFGDTTW
RIQGRDLAVNDIVEVVSVDSITLKVKKI
Download sequence
Identical sequences A0A1C7BTT1 C9R5E8
WP_005568766.1.101610 WP_005568766.1.12069 WP_005568766.1.13356 WP_005568766.1.13588 WP_005568766.1.16246 WP_005568766.1.18228 WP_005568766.1.63179 WP_005568766.1.69783 668336.D11S_1671 gi|261868331|ref|YP_003256253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]