SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI142734 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI142734
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily UBC-like 3.02e-51
Family UBC-related 0.00000599
Further Details:      
 
Domain Number 2 Region: 128-195
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000511
Family UBA domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI142734
Sequence length 196
Comment (Phytophthora sojae)
Sequence
MAPGGRVRKELEECQKDSHLSGVTAVPVNAASLSELRGTIQGPEATPYEGGHFELEIVIP
PKYPFEPPQMRFITKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEPT
DPQDAEVAKMYLHDHEQFLSTARFWTESYARQTDTGDDAALSRLIDMGFPADKAKAALLA
ANGDENAAIEKLVSSM
Download sequence
Identical sequences 67593.JGI142734 jgi|Physo1_1|142734|estExt_fgenesh1_pg.C_1210001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]