SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI143091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  67593.JGI143091
Domain Number - Region: 54-100
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0745
Family CRAL/TRIO domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI143091
Sequence length 125
Comment (Phytophthora sojae)
Sequence
MLAGGGQNLQMVAYIGKVGVIHYEMKLGSNKYQHSNEFVRNTLRKFADVSKVVVVLYNTP
CNARAFKSAVKDFMTERRAEIIAVPPGTTMKAHLQHFPIEAAETLFPRVTTAQLFLVKVA
ALEGC
Download sequence
Identical sequences jgi|Physo1_1|143091|estExt_fgenesh1_pg.C_1290001 67593.JGI143091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]