SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 684738.LLKF_0474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  684738.LLKF_0474
Domain Number 1 Region: 785-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-115
Family PFOR PP module 0.0000000132
Further Details:      
 
Domain Number 2 Region: 412-659
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.89e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000349
Further Details:      
 
Domain Number 3 Region: 3-255
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.24e-68
Family PFOR Pyr module 0.0000000341
Further Details:      
 
Domain Number 4 Region: 257-409
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.57e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000374
Further Details:      
 
Domain Number 5 Region: 667-830
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.19e-21
Family Ferredoxin domains from multidomain proteins 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 684738.LLKF_0474
Sequence length 1223
Comment (Lactococcus lactis KF147)
Sequence
MKKTMDGNMAAAHIAYAFSEIAVIYPITPSSPMADYTDAWSVAGRKNIWGSTVKITELQS
EAGAAGAMHGVLKAGGLATTYTASQGLLLMLPNMYKMAGELLPAVIHVAARAVAAGALNI
FGDQSDVMSARTTGFAMLAESSVQEVMDLSAVAHLATLEGSVPFLNFFDGFRTSHEIQKI
DVIDYQDLLPMVNQEKLADFRDRAMNPDHPTVSGTNQNADIYFQQRETVNSYYEALPEIV
QKYMGKINKLRGTDYDLVNYYGAPDATEVIVSMGSVAGTIEQTVDYLNGQGRKVGFINVH
LYRPFPLENFLEKLPKTVKSVAVLDRTKESGSNGEPLFLDVQSALFNSNVKQVIGGRYGI
GGKDTRPEHIVSVFDELVKAQPKRMFTIGINDDVTNLSLTNSKVLDLTPADTFQAKFWGF
GSDGTVGANKAAIKIIGDHTDKYVQAAFEYDSKKSGGLTISHLRFGDSPITSEYMTATLD
FVACHNMTYVRKYNLTKGLKAGGLFLLNTSWNLEQLSKNLPNEMKKFIAENQIRFYTIDA
MKIAHETGMERRINTIMQVAFFKLAHVMPFDEAYEILKKDAQKYAKKSPTIVEQNLNAMA
LALNGLHEVKIPESWAETQEEKTKVLTTESSRKKYVFEIVNKTNAFEGDELSVQTLVDNK
MTFGDEPLGTSASEKRGIALEIPEWNAQACIQCNECSFVCPHAAIRPFLVDEDEWNQAPE
GFHVMDYKGADGLKYRIQVSVEDCTGCGLCVEACPKKGEALKMIPYEGQEKESVNWAFAQ
TLKTKENPARPGTIVASQFEKPLFEFSGACSGCGETPYIKLLTQMFGDRMMISNATGCSA
IYGGTQATPYTTNEFEQGPAWSNSLFEDNAEYGYGMWLASQTRRQKLAAQVLEALPEMSD
DLQKLAKDWVEHLEDSEGTRARAEKMKGMLASEHFNSAKLDEIYKQKDQFVKPTQWIFGG
DGWAYDIGFGGLDHIVASGADVNILVMDNEVYANTGGQVSKATPASAIAQFAAGGKSNTK
KDLGAMLMTYGDVYVAQIASGANMMQTIRAFDEAEKFKGPSVIIAYTPCISHGLYGGIHL
ALDEAKEAVNSGYWQLYRYNPLLEDLGKNPMILDFKKPDFSKVRDFLLTQSRFGNLLKVD
AEHAESLYAKAAKDSRKRFMRYARTSGDLDKYLEREAKALAKKNPESEGTIEATLPKEPK
KRPVDPEREARRAARKAEREAKK
Download sequence
Identical sequences D2BNV3
684738.LLKF_0474 gi|281490964|ref|YP_003352944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]