SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 688245.CtCNB1_3584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  688245.CtCNB1_3584
Domain Number 1 Region: 101-155
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000017
Family DnaJ/Hsp40 cysteine-rich domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 688245.CtCNB1_3584
Sequence length 232
Comment (Comamonas testosteroni CNB 1)
Sequence
MRRMHCGPSQFRHVLTENFRALGMVFASDRGAMIAIPEDDAPLCTATPVKSMEATLDQLH
LQLVETPKSAWRAFAPLLEHPKLQDLEECPECKGCGWMTTATCPQCNGMGEHHDRGEFDP
CYECGESGEVDRPSADIAGAFACDLCKGAGDIPKDRFLKRFCNIPLPDTPHCFGIDAKYV
RLLAQLPNAQWAPPQRIAEYDCGAILLRFDTGWGAIMPLRESLIPTPHQARH
Download sequence
Identical sequences D0J4B6
WP_012839412.1.54103 gi|264679717|ref|YP_003279626.1| 688245.CtCNB1_3584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]