SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 688245.CtCNB1_4740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  688245.CtCNB1_4740
Domain Number 1 Region: 749-993
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0099
Further Details:      
 
Domain Number 2 Region: 29-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-19
Family Pyruvate oxidase and decarboxylase Pyr module 0.068
Further Details:      
 
Domain Number 3 Region: 460-648
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.27e-16
Family Pyruvate oxidase and decarboxylase PP module 0.06
Further Details:      
 
Weak hits

Sequence:  688245.CtCNB1_4740
Domain Number - Region: 282-367
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0149
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 688245.CtCNB1_4740
Sequence length 1192
Comment (Comamonas testosteroni CNB 1)
Sequence
MNAPLPDEVRRALESVTLDDKYSLARGRAFMSGVQALVRLPMLQRLRDAQAGLNTAGFIS
GYRGSPLGTYDQSLWAAKKHMEANHIVFQPGVNEELGATAVWGTQQLDLYPETKKFDGVF
GIWYGKGPGVDRCSDVFKHANMAGTAKHGGVIAIAGDDHISKSSTAAHQSDHIFKACGTP
VFFPSNVQDILDMGLHAFAMSRFSGLWSGMKTIQEVVESSSSVLVDPDRVNIILPEDFQM
PDGGLHIRWPDPPLEQEARLMNYKWYAALAYVRANKLNHNVIEGPNDRFGIIASGKAYND
TRQAMADLGLDEDTCRELGIRLHKVNVVWPLEATITRDFARGLQEILVVEEKRQVIEYQI
KEELYNWRDDVRPNVVGKFSDEHGGEWSLPNPSTDWLLRPTADLTPAIIARAIAQRLKKL
GVPEHVQTRMQQRLAVLDAREAAIKAAKEVSTGDRTPWFCSGCPHNTSTRVPEGSRAVAG
IGCHYMTTWMPDRRTSTFTQMGGEGVTWVGQAPFTKEAHVFANLGDGTYFHSGLLAIRQS
IAAGTNITYKVLYNDAVAMTGGQRVGERPEGHSVLQIMNSLLSEGVGKLVIVTDEPEKYD
GVKLGEGVTVHHRDELDAIQRQFRELKGCTAIIYDQTCATEKRRRRKRGVLSTPDKTVVI
NELVCEGCGDCSVQSNCLSVEPVETEFGRKRRINQNSCNKDYSCVKGFCPSFVTVEGGQL
KKPKQEKKGSLEALPIIPEPVLPVAEQAWGIVVAGVGGTGVITIGSLLGMAAHLEGKGVV
TQDAAGLAQKGGSTWSHIQIANRADAIYTTKVDMAKADLVIGCDPIVAATPTTLSVMQPG
RTYVALNSHAAPTATFVGNPDWQSPAARCATALAEAVGHGALGSFDAEKASTALLGDSIY
ANPMMLGYAWQKGRVPLSHASLMRAMELNGVQVARNQEAFEWGRRCAHDLEAVRALYQAS
QVIQFVKKPSLEEMLDKRVEFLTAYQNAAYAQQYRDFVAKVRAAEEPLAQGTRLSQAVAR
YLFKLMAYKDEYEVARLHTDAAFTQKISEMFEGDYKLVHHLAPPGFAKKDEQGHLLKKSY
GPWMRKAMGWLAGMKGLRGTALDPFGRTEERRTERALIVEYRQCIETLLTGLTADKLALA
VEIASTPEDIRGYGHVKEHHLAAARIKWQSLMTRWNGSAAPAAPAVKLMAVN
Download sequence
Identical sequences D0IY89
gi|264680872|ref|YP_003280782.1| WP_012840338.1.54103 688245.CtCNB1_4740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]