SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69014.TK0003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69014.TK0003
Domain Number 1 Region: 64-126
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000902
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69014.TK0003
Sequence length 129
Comment (Thermococcus kodakaraensis KOD1)
Sequence
MTLKGVLKLLLLSADEIAVAVFIFVVLPGFGVDVPLKVSVPLLVLLLLKDILIAPYVLGG
GLEKRPLTGPEALIGMEAVVVEDLSPEGIVKVGNELWRGVCLNGRAKRGEKVRIVGFRGN
LLLLERPES
Download sequence
Identical sequences Q5JEA5
WP_011248958.1.23727 gi|57639938|ref|YP_182416.1| 69014.TK0003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]