SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69014.TK0347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69014.TK0347
Domain Number 1 Region: 10-193
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.26e-30
Family Clp protease, ClpP subunit 0.046
Further Details:      
 
Domain Number 2 Region: 374-443
Classification Level Classification E-value
Superfamily NfeD domain-like 7.59e-19
Family NfeD domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69014.TK0347
Sequence length 447
Comment (Thermococcus kodakaraensis KOD1)
Sequence
MKPMKRPMVLTILLVVLILLPSVSAEKRVVYVGTIEGTITQYTVDQFESYIRTAEKNSAE
ALIIELNTPGGQGDAMMEIVSLIQNSTVPVIIYVYPRGAIAASAGTYIAMASHLIAMAPG
TSIGACEPILGYSANGSIVRAPDKIRNFYAAYMRSLAEASGRNETAAVKFVLEDLSLTPE
EALKANVIEVIANDLPDLLKKANGMRTKVPVAGKGYVTFNFTNVEVKRLSPSLSYQIVTF
LANPGIAYILLTVGMLGLVFGFLTPGWHVPETLGAILLVLGVIGMGYFGYDAAGLVLMIL
GVIFFIAEALTPTFGLFTIAGLVSFILGGLIMFGKGGEVYLVNSETFSTLRVIIIVTGVL
LALFFLFGMAAVIRAHRRRPETGKEEMIGAVGKVVEDLDPEGLIKVRGELWKAVSKDGSL
IKVGEKVRVVGMDGLTLIVEKVDEKEV
Download sequence
Identical sequences Q5JG17
gi|57640282|ref|YP_182760.1| WP_011249302.1.23727 69014.TK0347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]