SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000014619 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000014619
Domain Number 1 Region: 28-207
Classification Level Classification E-value
Superfamily TIMP-like 1.04e-70
Family Tissue inhibitor of metalloproteinases, TIMP 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000014619
Sequence length 220
Comment (Gasterosteus aculeatus)
Sequence
EMTWTANSGLATLVILFLWRVDEIAEACSCSPAHPQQAFCNSDVVIKAKVVGRHAVDVGN
DIYGNPVKQIKYDLKQIKMFKGPTQDFDAMYTPPISALCGVTLENDGKEYLITGKLETDG
TMHVTLCDFIHPWEALSATQKKSLTQRYEMGCDCKITRCTSIPCMISGPAECLWTDWVIE
RTVNGGQAKHFACVKRSDDSCAWYRGEASPKKDFLDIEDP
Download sequence
Identical sequences G3PAJ5
ENSGACP00000014619 69293.ENSGACP00000014619 ENSGACP00000014619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]