SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW013082-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW013082-PA
Domain Number 1 Region: 6-117
Classification Level Classification E-value
Superfamily UBC-like 8.52e-25
Family RWD domain 0.00023
Further Details:      
 
Domain Number 2 Region: 126-159
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000662
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW013082-PA
Sequence length 193
Comment (Ixodes scapularis)
Sequence
MSSEEDSSLEVEIEALKAIYIHELQVTYNDRDRPTSLRVSLHPATADNAEEQYVRLELVL
SLLPEYPNALPEVAIRNPRGLSDEKIERIRRDVQETARENAGGPMLYQLIEVAKDHLTEE
NVPCCQCTICLYGFAEGDVFTKTQCYHYFHSHCLGRYVSHALGQMAREHEAKLSPAHEKP
ESPDKYGRALFRR
Download sequence
Identical sequences B7QF13
XP_002414127.1.51680 ISCW013082-PA 6945.ISCW013082-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]