SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 70601.PH0471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70601.PH0471
Domain Number 1 Region: 73-142
Classification Level Classification E-value
Superfamily NfeD domain-like 3.4e-24
Family NfeD domain-like 0.000012
Further Details:      
 
Weak hits

Sequence:  70601.PH0471
Domain Number - Region: 20-99
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit III-like 0.0262
Family Cytochrome c oxidase subunit III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 70601.PH0471
Sequence length 143
Comment (Pyrococcus horikoshii)
Sequence
MSMGIAFPLSLLILGLLIILLDMMISAFITPIGIAFSVLGLLLLFNVNFYLSFIVSLISA
VIAYMAFARVVRRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLS
LGDRVMVVDVDGLKLKVKRIPPQ
Download sequence
Identical sequences O58204
WP_010884582.1.38245 GO.2701 70601.PH0471 gi|14590384|ref|NP_142450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]