SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 70601.PH1510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70601.PH1510
Domain Number 1 Region: 24-186
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.43e-29
Family Clp protease, ClpP subunit 0.017
Further Details:      
 
Domain Number 2 Region: 366-433
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000000262
Family NfeD domain-like 0.002
Further Details:      
 
Weak hits

Sequence:  70601.PH1510
Domain Number - Region: 242-370
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0536
Family Glycerol-3-phosphate transporter 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 70601.PH1510
Sequence length 441
Comment (Pyrococcus horikoshii)
Sequence
MRRILLSMIVLIFLASPILAKNIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIEL
DTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGAC
RPILGYSQNGSIIEAPPKITNYFIAYIKSLAQESGRNATIAEEFITKDLSLTPEEALKYG
VIEVVARDINELLKKSNGMKTKIPVNGRYVTLNFTNVEVRYLAPSFKDKLISYITDPNVA
YLLLTLGIWALIIGFLTPGWHVPETVGAIMIILAIIGFGYFGYNSAGILLIIVAMLFFIA
EALTPTFGLFTVAGLITFIIGGILLFGGGEEYLVRKEVFSQLRILIITVGAILAAFFAFG
MAAVIRAHKKKARTGKEEMIGLIGTVVEELNPEGMIKVRGELWKARSKFNGKIEKGEKVR
VVDMDGLTLIVVRERKEGGEK
Download sequence
Identical sequences O59179
WP_010885587.1.38245 70601.PH1510 gi|14591292|ref|NP_143370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]