SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL008009-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL008009-PA
Domain Number 1 Region: 34-144
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.7e-20
Family Insect pheromone/odorant-binding proteins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL008009-PA
Sequence length 148
Comment (Aedes aegypti)
Sequence
MYRKTLLAFFFFLFLSCGDAVQNLTALRGSDYPPMYLINLVKSALERCHQLIDIEDSVIV
RFRDDGDYEGTEQLGCYLHCVFREKGYWIPEKSEVDIMKILDIVPKDFEQPALKMGLRCL
KVKGDDDCSRSLWYHSCWKKNDPAKVES
Download sequence
Identical sequences Q16ZZ6
AAEL008009-PA 7159.AAEL008009-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]