SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL014876-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL014876-PA
Domain Number 1 Region: 42-151
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000000327
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 
Weak hits

Sequence:  7159.AAEL014876-PA
Domain Number - Region: 174-241
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0327
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL014876-PA
Sequence length 299
Comment (Aedes aegypti)
Sequence
SIELSNRPSTIMNRIVLLVLISLCSASTVLADGLPHYIAENSFDISLRVCAEYFLVSNET
IDGYYQQGFPEIEEVKQLLRCAMINLGAYDDTFGPLEYVLGNVFKPCPSDTEYAERTRSC
VKKALDSICPSDVFSRAYASFMCYYRGYGNLITDEFFIPNSLLELTQMMLFVQSSLNLPD
EVLVQYSQGNILNEPNFPNVLYVWAVRGGYFSVDEGIQLENLYIQYGIPGLLSQETRQCA
ADVAQANCNLDLVTLLYNMYVTCLRPLLPFESFVQTFAVEQLKCKTCGAVQPAKPSYTY
Download sequence
Identical sequences Q16F71
AAEL014876-PA 7159.AAEL014876-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]