SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ004508-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ004508-PA
Domain Number 1 Region: 14-142
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-45
Family Regulator of G-protein signaling, RGS 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ004508-PA
Sequence length 159
Comment (Culex quinquefasciatus)
Sequence
MANSDSDLFLDTRPTLEEIRSWGKSFDKLMRSPSGRKAFREFLRCEYSEENILFWLACEE
LKKETNPEAIEEKARFIYEDYISILSPKEVSLDSRVREIVNRNMVEPTPHTFDEAQLQIY
TLMHRDSYPRFINSSQFKTLAQIPDGVSASGSTAESPSN
Download sequence
Identical sequences B0WC38
7176.CPIJ004508-PA XP_001846272.1.94360 CPIJ004508|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]