SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ018495-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ018495-PA
Domain Number 1 Region: 143-213
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 220-266
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ018495-PA
Sequence length 311
Comment (Culex quinquefasciatus)
Sequence
MLINLKLTRVRNQSQRPYLQRDQQQLSLQSALSTSSSSSAASSYYSAYGDPHHDPLAPPQ
PPPLLPPQPAPTLGPLVRTSSSSSVVTMTMASAGSAGLSLANCANNGTQDLQQQQSGKQP
SSPDGTRYGQCPPPLVQKTKARDITKRRGAIKHQRTHEINGHKFVAKFFRQPTFCAFCKE
FLWGFGKQGYQCKTCQTAVHKKCHEKLLGSCSESSFNSESTIYLRERFKIDLPHRFRVYT
FMSPTFCDHCGSLLYGFFRQGLKCEVLYTTNGKKLQSKAPRCGKPAKLPKFAQRWQHRSN
LNRFTAHEKKI
Download sequence
Identical sequences B0XHL7
CPIJ018495|predicted 7176.CPIJ018495-PA XP_001869139.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]