SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0121308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7217.FBpp0121308
Domain Number - Region: 15-66
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0119
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0121308
Sequence length 71
Comment (Drosophila ananassae)
Sequence
MNGPETEPQTKTWPGRDRSGLERAGRTGKAGEGTEGRTPQKPVDGAHWLADNDDGNVVVV
VDEYGMGIGYR
Download sequence
Identical sequences 7217.FBpp0121308 FBpp0121308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]