SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0121711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0121711
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.55e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0121711
Sequence length 164
Comment (Drosophila ananassae)
Sequence
LNGKQTEGIFRVSADVDEVNCMKNRLDRWDVPDYKNTLVDAHAPASLLKLWYRELYDPLI
PDAYYEDCVNTEDPDKAKEIVNKLPEINQLVLTYLIHFLQQFSNPEVVSCTKMDSSNLAM
VFAPNCLRCTSEDPKVILENARKEMSFMRTLIQHMDTSHVSNLV
Download sequence
Identical sequences 7217.FBpp0121711 FBpp0121711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]