SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0122375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7217.FBpp0122375
Domain Number - Region: 38-115
Classification Level Classification E-value
Superfamily Vanabin-like 0.00124
Family Vanabin-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0122375
Sequence length 134
Comment (Drosophila ananassae)
Sequence
MNDENPSVEEQRERIDNAMINALDDLDREYLRKLQVQMHVCATKCCTDADASAEAVQRCV
DRCQLPLTRARCYVQQELSDFENRLEACVQKCHRMLGGIGDCHLERCSIECIDGHVALLP
EMLRAMRVTLEKGL
Download sequence
Identical sequences 7217.FBpp0122375 FBpp0122375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]