SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0151835 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0151835
Domain Number 1 Region: 37-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000144
Family Insect pheromone/odorant-binding proteins 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0151835
Sequence length 161
Comment (Drosophila grimshawi)
Sequence
MTQMEKQQQHTWLSVLLVLACAGAWLSLVHAEDDDSMTLQEVVEMIEPFGQGCDPKPEQS
HFEEMVLNKEDASHESKCLRRCLLKQFDLMPEGTTQFNEAKTNEMMNMMFSDKEDQSKII
MSKCNLAVTDVSDECEVAHFISMCMLNEMRNADYKIPNIKE
Download sequence
Identical sequences B4JXD2
FBpp0151835 7222.FBpp0151835 XP_001995756.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]