SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0156926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0156926
Domain Number 1 Region: 10-131
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.79e-22
Family Insect pheromone/odorant-binding proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0156926
Sequence length 135
Comment (Drosophila grimshawi)
Sequence
MMRATLFAATLVFAVAVVQSDPNFPQLMKQCLEETKVSEPELKEFMNSGMMTNPNENIKC
YTKCLMEKQGHMVNGQFQADAMMATLRNVPQLKDKLAEISSGVDACKAIGGTNDCDKAFK
ISMCLKEHKAKTMKN
Download sequence
Identical sequences B4JWD7
7222.FBpp0156926 XP_001995203.1.65300 FBpp0156926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]