SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0157756 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0157756
Domain Number 1 Region: 26-81
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000072
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0157756
Sequence length 84
Comment (Drosophila grimshawi)
Sequence
MCAKQTNFKLLTRNEEAIEDLTVDQVMSGSCWADCVFEHYKFMVNGSLDMEAVRSHYRTF
HKQDPEYETEMLIAFERCHSKRKH
Download sequence
Identical sequences B4K476
7222.FBpp0157756 XP_001998080.1.65300 FBpp0157756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]