SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0078266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0078266
Domain Number 1 Region: 27-138
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 6.15e-24
Family Insect pheromone/odorant-binding proteins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0078266
Sequence length 146
Comment (Drosophila melanogaster)
Sequence
MQSQSLLLIVAAVATFLVAQTTAKFLLKDHADAEKAFEECREDYYVPDDIYEKYLNYEFP
AHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSKDLSTVQHGLEKCIDHNEAES
DVCTWANRVFSCWLPINRHVVRKVFA
Download sequence
Identical sequences Q8MZ07
7227.FBpp0078266 FBpp0078266 NP_731043.1.81976 FBpp0078266 FBpp0078266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]