SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0272873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0272873
Domain Number 1 Region: 64-175
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.76e-32
Family Frataxin-like 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0272873
Sequence length 190
Comment (Drosophila pseudoobscura)
Sequence
MFTRRAVARLSRLNTRSATAAGYHSLCWPNTNQNRVPTATTASEVFNQNNGPLRRRLFSS
QIETESSLDTATYERVCSETLDGLCDYFEELTENATDLIGTDVAYGDGVLTVNLGKSHGT
YVINRQTPNKQIWLSSPTSGPKRFDYVGTPKAGKWIYRHTGQSLHQLLQLEIPNIVKSQT
VDFMQLPHCS
Download sequence
Identical sequences Q29GX6
7237.FBpp0272873 FBpp0272873 XP_001354927.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]