SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0254528 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0254528
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000837
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0254528
Sequence length 155
Comment (Drosophila willistoni)
Sequence
MHLCLMLALMLMLGLLVQSPTIGIDGAPTSSSRRLLTARDYCFRSGKLSDRQRLRLDHMA
YENQEYAHRYAYCFWTKLHLWNDQNGFQAMQIVNHFGGPDRLNVEQAVPVINKCNLSTRP
GAASNWCYRAFVCVLRTPVGEWFRRHMSDVINGNA
Download sequence
Identical sequences B4NDY9
7260.FBpp0254528 FBpp0254528 XP_002070972.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]