SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001600575 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001600575
Domain Number 1 Region: 105-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000353
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001600575
Sequence length 206
Comment (Nasonia vitripennis)
Sequence
MASLVADYGTSSGSESERDELSDSESSKDEAEEEKNIENEDEENQKDIASNNKLPLPTPD
FNGAPTMKTSVFKNPFVEAEKAKSAILEKHVKMTPTLDDTKMINGRKICWNYRKGRCRFG
HNCTFAHDSDLHRSAAELEAMRAPQETIICQTQYNGQVRINDDDEVDQENNQTQKRKKRP
GLSQTLVPGKKVLKMYKAQQAKAVSR
Download sequence
Identical sequences K7IVI5
XP_001600575.1.61660 gi|156547008|ref|XP_001600575.1| 7425.XP_001600575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]