SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001604645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001604645
Domain Number 1 Region: 26-126
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000144
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001604645
Sequence length 188
Comment (Nasonia vitripennis)
Sequence
MKRFIIIVCFYFIYLHTSSARRSDNLKKCLVEHGLRNKLYKRAIGGSNINSLDRDVNVDL
KEKLACTLACSFRKEHSGNETLHAIFTEALNFGNFHILEDVKQQMRETLNNCYTEVESND
CKLLHCIKIIESQFMDVVLAITNERPVRLSFENTNSVKKFKKIKFRIKWFKVMHMMIRSL
QRHIPYKQ
Download sequence
Identical sequences G8B1Q4
XP_001604645.1.61660 gi|156546218|ref|XP_001604645.1| 7425.XP_001604645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]