SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 74547.PMT1300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  74547.PMT1300
Domain Number 1 Region: 92-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000157
Family NfeD domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 74547.PMT1300
Sequence length 147
Comment (Prochlorococcus marinus MIT9313)
Sequence
MPSPTWIPLIWLAVAGLLLAIELAQPSFDGLMFAALGALVVSILAAITPMPLILQMIFFL
LITVLGTLWLTRWSARRNPSPDGLRQREDIAEVLTPIKAGGDGRVRWHGQSWAASSIDLE
TPINAGDQVVVMGREGTQLQVLPLPRR
Download sequence
Identical sequences Q7V673
gi|33863568|ref|NP_895128.1| WP_011130669.1.51355 74547.PMT1300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]