SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001201579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001201579
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000275
Family DNA repair protein MutS, domain III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001201579
Sequence length 59
Comment (Strongylocentrotus purpuratus)
Sequence
LDAIADLHSNPDIVAEVVELIKKLPDLERLLSKIHTLGSSKRNSDHPDSRAIFFEDAVY
Download sequence
Identical sequences 7668.XP_001201579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]