SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 76869.PputGB1_1402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  76869.PputGB1_1402
Domain Number 1 Region: 94-177
Classification Level Classification E-value
Superfamily SMR domain-like 3.4e-16
Family Smr domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 76869.PputGB1_1402
Sequence length 186
Comment (Pseudomonas putida GB 1)
Sequence
MQDDDFSLFKAEVRGVKQIRHDRAEVGKPKADRQKLAGLRQAATVRSDKALVIDGMSDLF
VIDVGAEDELMWRRDGVQEGQLRKLKLGQIPFEGSLDLHGMTVEKARETLWDFIAEATKL
EVRCVRVTHGKAARLDGKRPMIKSHVNTWLRQHPQVLGFASCSARHGGTGAVYVMLKRTM
LEGRDE
Download sequence
Identical sequences B0KUK4
WP_012271078.1.13892 WP_012271078.1.65540 WP_012271078.1.66485 WP_012271078.1.81634 gi|167032414|ref|YP_001667645.1| 76869.PputGB1_1402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]