SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000025778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000025778
Domain Number 1 Region: 163-215
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.0000000000000209
Family Eferin C-derminal domain-like 0.00047
Further Details:      
 
Weak hits

Sequence:  7719.ENSCINP00000025778
Domain Number - Region: 79-148
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00157
Family Mitotic arrest deficient-like 1, Mad1 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000025778
Sequence length 215
Comment (Ciona intestinalis)
Sequence
KLEREKELQLQVLQGRLDLKTSENDRLEIEVGQLKSMAKEAKRDQSKSLSKNEELTQQLV
ETNEEYRRLLNQRFTLQQDKHDTEQQRLQEMLGCLQSQLESTQNEKEVLDEQVALLRTNP
QSASLQAHVEDLRSENDKLKLTNEELNDQLAQNITDVRSLMNGDQSIARELSDASKDDLM
EELKKQEQINNQLRDYLDRIILSVLERDPTILEIK
Download sequence
Identical sequences 7719.ENSCINP00000025778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]