SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI257909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI257909
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.71e-18
Family BCR-homology GTPase activation domain (BH-domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI257909
Sequence length 114
Comment (Branchiostoma floridae)
Sequence
MEDNQIAVLRLLLALLPVPNRDTLYALLQFLAVVDRHSQDSVDENGQEVPGNKMDSHNLG
TLFGPNILYRDRDPNPNDGDAANRVDEQRDVIQVIKFMIENHEKLFKVQQRDSI
Download sequence
Identical sequences C4A0J1
XP_002585679.1.56174 7739.JGI257909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]