SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI62661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI62661
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.92e-27
Family Complement components 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI62661
Sequence length 84
Comment (Branchiostoma floridae)
Sequence
MGPTLSGLDKLVRLPTGCGEQNMVMFAPNIFVMQYLDTTNQLSSEIKDKSLEYMKIGYQR
ELTYKHKDGSYSAFGESDDSGSTW
Download sequence
Identical sequences C3ZYP4
7739.JGI62661 XP_002586335.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]