SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 78245.Xaut_1881 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  78245.Xaut_1881
Domain Number - Region: 93-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00183
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 78245.Xaut_1881
Sequence length 150
Comment (Xanthobacter autotrophicus Py2)
Sequence
MLADLGPLLGPWAWFILGGVLLVAEIAAPGAFLLWLGLAALVTGALSYVVGLTWQSEVLA
FAALAVIAVLIGRRISPAPGRASDRPFLNRRSEGFVGRVFTLDEPILGGVGRVRIDDTVW
RIEGPDLAAGRDVKVIAADGATLKVEAVEG
Download sequence
Identical sequences A7IGI3
gi|154245825|ref|YP_001416783.1| 78245.Xaut_1881 WP_012113904.1.63109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]