SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000018696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000018696
Domain Number 1 Region: 442-702
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-52
Family YWTD domain 0.000000058
Further Details:      
 
Domain Number 2 Region: 28-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000668
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 3 Region: 234-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000393
Family LDL receptor-like module 0.00039
Further Details:      
 
Domain Number 4 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000877
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 5 Region: 148-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 6 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00042
Further Details:      
 
Domain Number 7 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 8 Region: 192-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 9 Region: 396-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000479
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 10 Region: 318-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00038
Further Details:      
 
Domain Number 11 Region: 360-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000175
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 12 Region: 705-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000317
Family EGF-type module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000018696
Sequence length 847
Comment (Oryzias latipes)
Sequence
MVTSAAGVLLLPVLLILLCLHHRGHVHATKTECETNQFQCGNGRCIPSIWQCDGEDDCTD
GSDEKSCVQKTCAEVDFVCRNGQCVPKRWHCDGEPDCEDGSDESLEICHMRTCRVNEFSC
GAGTTQCIPVSWKCDGEKDCDNGDDEVNCGNITCSPSEFTCTSGRCISQNFVCNSEDDCG
DGSDEVDCAPSSCGPSEFQCGNSSCIPASWVCDDDVDCQDQSDESLSRCGRHPTPPAKCS
SSEMQCLSGECIHKKWRCDGDPDCKDGSDEANCPVRTCGPDQFKCEDGSCIPGSRQCNGI
RDCTDGSDEVDCKNLSQCSGPEKFKCRSGECIDMSKVCNKVRDCPDWSDEPIKECNVNEC
LLNNGGCSHICKDMVIGFECDCTPGLQLIDHKTCGDINECMNPGICSQICINLKGGYKCE
CHNGYQMDPTTGVCKAVGKEPCLIFTNRRDVRRLGLERKEYTQIVKQQRNAVALDADFNQ
QTIFWADLGQKAIFSTVLDKRGDVGTHKTVIENVQTPVGIAVDWIYRNFYWTDLGTKTIS
VSNFNGTIQKVLFNQGLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGVDRQVLVETD
IQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRKKVLQSPEYLAHPFALTVFEDRVF
WTDGENQAIYGANKFSGSDVVTLASNLNDPQDIIVYHELIQLSGTNWCTERGVNGGCSFM
CLPAPQVNKHSPKYTCVCPEGQELAADGFRCRPEANGSTSIQVDSTARGSAGAWAILPVL
LLAVAGAAGYLTWRNWQLRNQKSMNFDNPVYLKTTEEDLNIDITRHGANVGHTYPAISIV
STEDDSS
Download sequence
Identical sequences H2MJ58
XP_004075190.1.28442 ENSORLP00000018696 ENSORLP00000018696 8090.ENSORLP00000018696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]