SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000005765 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  8364.ENSXETP00000005765
Domain Number - Region: 44-128
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00667
Family CRAL/TRIO domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000005765
Sequence length 130
Comment (Xenopus tropicalis)
Sequence
MDSVDFEKLAEIELQKDEEDLEYLGPPVVSGGRKPSDVCIGHPYYDIARHGILHVVGTNL
YPHTVLSKGNTMAPPTHIIKKQGAFGYMKHTLDQYVENDYTLVYFHYGLNSRNKPSLGWL
QSAYKEFDRK
Download sequence
Identical sequences F7A0E4
8364.ENSXETP00000005765 ENSXETP00000005765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]