SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 85643.Tmz1t_0138 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  85643.Tmz1t_0138
Domain Number 1 Region: 86-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000017
Family NfeD domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 85643.Tmz1t_0138
Sequence length 151
Comment (Thauera MZ1T)
Sequence
MNDTMFLEWWHWEIAGIALVLLELALPSFFIIWFGLGAMLTGFVLLAMPDLALSQQIAVW
IIASMAMTVLWFSFAKRARVRTLIGTAAGEVIGEVGLLVSAVAPFERGKVRFQRPVLGAD
EWACVAESAIAAGERVKVVSVEGSYVKVTKA
Download sequence
Identical sequences C4ZKX7 N6XSD3
gi|217968597|ref|YP_002353831.1| 85643.Tmz1t_0138 WP_004311856.1.50204 WP_004311856.1.58410 WP_004311856.1.88725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]