SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 85643.Tmz1t_0456 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  85643.Tmz1t_0456
Domain Number - Region: 79-151
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0432
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 85643.Tmz1t_0456
Sequence length 210
Comment (Thauera MZ1T)
Sequence
MNLHPFLVAIEVGGTLAFAMSGLIEATRKRMDIVGVFSVAFVSAFGGGTLRDILLDRRPL
FWIENQEYLWLVLAMVATTPLWLQTLRHKVGGRLMELADALGLGLFAISGATLADAAGMP
VLVSMMMGAITAVFGGVSRDVLCNEVPKVYSDHRPYAMCALFGCGVFLALDAIGLPLPIA
TLAGIAAATGSRLLALVFDVRLPAWPAHRD
Download sequence
Identical sequences A0A1V5F8G6 C4ZIU8 N6Z2X4
85643.Tmz1t_0456 WP_004265386.1.50204 WP_004265386.1.58410 WP_004265386.1.88725 gi|217968897|ref|YP_002354131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]